Structure of PDB 7szi Chain C Binding Site BS01

Receptor Information

>7szi Chain C (length=342) Species: 573 (Klebsiella pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQ
LTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVY
DVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQ
YQGKNGSVSGEGATNNGRGWSKQNGDGFGTSLTYDGISAGFAYSHSKRTD
EQNSVPALGRGDNAETYTGGLKYDANNIYLASQYTQTYNATRAGSLGFAN
KAQNFEVVAQYQFDFGLRPSVAYLQSKGKDLERGYGDQDILKYVDVGATY
YFNKNMSTYVDYKINLLDDNSFTRNAGISTDDVVALGLVYQF

Ligand information

>7szi Chain D (length=9) Species: 573 (Klebsiella pneumoniae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CSGGQNTHC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7szi Mating pair stabilization mediates bacterial conjugation species specificity.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	R37 Y99 D106 E110 G113 Y116 G117 S118 S124 R125
Binding residue (residue number reindexed from 1)	R38 Y100 D107 E111 G114 Y117 G118 S119 S125 R126

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0015288	porin activity
GO:0046872	metal ion binding

	Biological Process
GO:0006811	monoatomic ion transport
GO:0034220	monoatomic ion transmembrane transport

	Cellular Component
GO:0009279	cell outer membrane
GO:0016020	membrane
GO:0046930	pore complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7szi, PDBe:7szi, PDBj:7szi
PDBsum	7szi
PubMed	35697796
UniProt	D6QLY0

[Back to BioLiP]