Structure of PDB 7s81 Chain C Binding Site BS01

Receptor Information

>7s81 Chain C (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKE
NRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKN
FTKYPKKFYPLEIDDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSIL
SEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKAE
MLDNLLDIEVAYS

Ligand information

>7s81 Chain D (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgcggccgcat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s81 Captured snapshots of PARP1 in the active state reveal the mechanics of PARP1 allostery.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	Y570 K600 K621 F638
Binding residue (residue number reindexed from 1)	Y40 K70 K91 F108

Enzymatic activity

Enzyme Commision number

2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.

Gene Ontology

	Molecular Function
GO:0003950	NAD+-protein poly-ADP-ribosyltransferase activity

View graph for
Molecular Function

External links

PDB	RCSB:7s81, PDBe:7s81, PDBj:7s81
PDBsum	7s81
PubMed	35793673
UniProt	P09874\|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 (Gene Name=PARP1)

[Back to BioLiP]