Structure of PDB 7rna Chain C Binding Site BS01

Receptor Information
>7rna Chain C (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY
EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP
VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rna Characterization of caspase-2 inhibitors based on specific sites of caspase-2-mediated proteolysis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R64 H121 Q161 C163
Binding residue
(residue number reindexed from 1)		R31 H88 Q128 C130
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7rna, PDBe:7rna, PDBj:7rna
PDBsum7rna
PubMed35642311
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]