Structure of PDB 7rm3 Chain C Binding Site BS01

Receptor Information
>7rm3 Chain C (length=222) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGW
INSNTGEPTYAEEFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARWA
NCGCAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rm3 Structural basis of Plasmodium vivax inhibition by antibodies binding to the circumsporozoite protein repeats.
Resolution2.68 Å
Binding residue
(original residue number in PDB)		G33 W50 N52 S52A W95 N97 G99
Binding residue
(residue number reindexed from 1)		G33 W50 N52 S53 W99 N101 G103
External links