Structure of PDB 7rm0 Chain C Binding Site BS01

Receptor Information
>7rm0 Chain C (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGW
INSNTGEPTYAEEFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARWA
NCGCAMDYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKG
YFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVT
CNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rm0 Structural basis of Plasmodium vivax inhibition by antibodies binding to the circumsporozoite protein repeats.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		T30 N31 Y32 G33 W50 N52 S52A N53 W95 A96 N97 G99
Binding residue
(residue number reindexed from 1)		T30 N31 Y32 G33 W50 N52 S53 N54 W99 A100 N101 G103
External links