Structure of PDB 7rlw Chain C Binding Site BS01

Receptor Information
>7rlw Chain C (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHVKSLEWIGRID
PYDGATSYNQNFKDKASLTVDKSSTTGFMELHSLTSEDSAVYYCAREGHW
DGDWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rlw Structural basis of Plasmodium vivax inhibition by antibodies binding to the circumsporozoite protein repeats.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		G31 Y32 Y33 W47 R50 D54 S58 E95 W100B
Binding residue
(residue number reindexed from 1)		G29 Y30 Y31 W45 R48 D53 S57 E97 W104
External links