Structure of PDB 7r80 Chain C Binding Site BS01

Receptor Information
>7r80 Chain C (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r80 Molecular basis of differential HLA class I-restricted T cell recognition of a highly networked HIV peptide.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y7 Y59 R62 N63 I66 F67 N77 I80 Y84 I95 R97 D114 Y123 T143 K146 W147 L156 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 Y59 R62 N63 I66 F67 N77 I80 Y84 I95 R97 D114 Y123 T143 K146 W147 L156 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links