Structure of PDB 7r7x Chain C Binding Site BS01

Receptor Information
>7r7x Chain C (length=277) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEPH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r7x Molecular basis of differential HLA class I-restricted T cell recognition of a highly networked HIV peptide.
Resolution2.099 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 T73 N77 Y84 I95 Y99 D114 Y123 T143 K146 W147 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 T73 N77 Y84 I95 Y99 D114 Y123 T143 K146 W147 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links