Structure of PDB 7r0w Chain C Binding Site BS01

Receptor Information
>7r0w Chain C (length=279) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPFWAQETAPLTPREATGRIVCANCHLAQKAAEVEIPQAVLPDTVFEAVV
KIPYDLDSQQVLGDGSKGGLNVGAVLMLPEGFKIAPPDRLSEGLKEKVGG
TYFQPYREDMENVVIVGPLPGEQYQEIVFPVLSPDPAKDKSINYGKFAVH
LGANRGRGQIYPTGLLSNNNAFKAPNAGTISEVNALEAGGYQLIGTETVD
IPAGPELIVSAGQTVEAGEFLTNNPNVGGFGQKDTEVVLQNPTRIKFLVL
FLAGIMLSQILLVLKKKQIEKVQAAELNF
Ligand information
>7r0w Chain H (length=29) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDILTLGWVSVLVLFTWSISMVVWGRNGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r0w Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L41 I251 V255 L258 M262 Q265 I266 V269 K272
Binding residue
(residue number reindexed from 1)		L41 I245 V249 L252 M256 Q259 I260 V263 K266
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r0w, PDBe:7r0w, PDBj:7r0w
PDBsum7r0w
PubMed35726684
UniProtP26287|CYF_SYNY3 Cytochrome f (Gene Name=petA)

[Back to BioLiP]