Structure of PDB 7qyr Chain C Binding Site BS01

Receptor Information
>7qyr Chain C (length=284) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKIAVLSRNPRLYSTRRLVEAGRERGHEMVVIDTLRAYMNIASHKPQIHY
RGQPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDK
LRSLQLLSRKGIGLPVTGFAHSPDDVPDLIEMVGGAPLVIKLLEGTQGIG
VVLCETEKAAESVLEAFMGLKHNIMVQEYIKEAGGADIRCFVVGDKVIAS
MKRQAAPGEFRSGSASLIKITPEERMTAIRAARVMGLNVAGVDILRSNHG
PLVMEVNSSPGLEGIESTTGKDIAGIIIQYLEKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qyr Structural insights into the mechanism of adaptive ribosomal modification by Pseudomonas RimK.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S7 L12 Y13 S14 R64 G66 S68 R189 G266
Binding residue
(residue number reindexed from 1)		S7 L12 Y13 S14 R64 G66 S68 R189 G261
Enzymatic activity
Enzyme Commision number 6.3.2.-
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0005524 ATP binding
GO:0016874 ligase activity
GO:0016881 acid-amino acid ligase activity
GO:0018169 ribosomal S6-glutamic acid ligase activity
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0009432 SOS response
GO:0036211 protein modification process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qyr, PDBe:7qyr, PDBj:7qyr
PDBsum7qyr
PubMed36134899
UniProtQ9HTZ2|RIMK_PSEAE Probable alpha-L-glutamate ligase (Gene Name=rimK)

[Back to BioLiP]