Structure of PDB 7pvx Chain C Binding Site BS01

Receptor Information
>7pvx Chain C (length=59) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYI
PSNYVAPSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pvx Crystal structure of the c-Src SH3 domain mutants of the specificity region in complex with polyproline peptides
Resolution1.43 Å
Binding residue
(original residue number in PDB)
Y90 D99 D117 W118 P133 N135 Y136
Binding residue
(residue number reindexed from 1)
Y8 D17 D35 W36 P51 N53 Y54
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:7pvx, PDBe:7pvx, PDBj:7pvx
PDBsum7pvx
PubMed
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]