Structure of PDB 7p3f Chain C Binding Site BS01

Receptor Information
>7p3f Chain C (length=147) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETCSLMVVK
RSGVTEPFSRTKVINGVRKACQGRPVTEDALAQLGQRVEEAVRATGSAEL
TTHDVGLAILGPLQELDLVAYLRFASVYRAFDSLEDFEAAIAELRET
Ligand information
>7p3f Chain F (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aatccccacatctagtggttggatagcgtgagcagcccacaagttgtggt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p3f A nucleotide-sensing oligomerization mechanism that controls NrdR-dependent transcription of ribonucleotide reductases.
Resolution3.31 Å
Binding residue
(original residue number in PDB)		R28 R37
Binding residue
(residue number reindexed from 1)		R28 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7p3f, PDBe:7p3f, PDBj:7p3f
PDBsum7p3f
PubMed35577776
UniProtO69980|NRDR_STRCO Transcriptional repressor NrdR (Gene Name=nrdR)

[Back to BioLiP]