Structure of PDB 7ozs Chain C Binding Site BS01

Receptor Information

>7ozs Chain C (length=239) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RSKRALEKRAPKIVENPKTCLFLRGTTCSQITQDAMNDLYAMRQVHAKRF
HKKNAIHPFEDATSLCFFSEKNDCSLMVFGSSNKKRPHTLTFVRMFDYKV
LDMLEFYLDPDTYRSISQFKTSKIPIGMRPMMVFAGTAFESPVPNAFTMA
KSMLIDFFRGEPSDKIDVEGLRFVVVVTADEPTSQKPILRLRVYGIRTKR
SGTRLPRVEVEEHGPRMDFRLGRMREPDPAMLKEAMKKA

Ligand information

>7ozs Chain 3 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acguacgaccauacccaguggaaagcacggcaucccguccgcucugcccu
aguuaagccacugagggcccgguuaguaguugggucggugacgaccagcg
aaucccggguguuguacgu

<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
.>>....>>>>>>.>><<<<<<......<<<.<<<<<....>>>>>>>>.
....>>>>>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ozs Structure of nascent 5S RNPs at the crossroad between ribosome assembly and MDM2-p53 pathways.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	N47 H61 K63 E70 N93 K94 K95 R96
Binding residue (residue number reindexed from 1)	N37 H51 K53 E60 N83 K84 K85 R86

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470	maturation of LSU-rRNA
GO:0006364	rRNA processing

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ozs, PDBe:7ozs, PDBj:7ozs
PDBsum	7ozs
PubMed	37291423
UniProt	G0SF80

[Back to BioLiP]