Structure of PDB 7nl0 Chain C Binding Site BS01

Receptor Information

>7nl0 Chain C (length=105) Species: 9606 (Homo sapiens)

KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ
AVLLP

Ligand information

>7nl0 Chain I (length=131)

cagtggtgagtattaacatggaacttactccaacaatacagatgctgaat
aaatgtagtctaagtgaaggaagaaggaaaggtgggagctgccatcactc
agaattgtccagcagggattgtgcaagcttg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nl0 Dissecting OCT4 defines the role of nucleosome binding in pluripotency.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): K15 R17 R32 R77
• Binding residue (residue number reindexed from 1): K3 R5 R20 R65

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0008285 negative regulation of cell population proliferation
• GO:0031507 heterochromatin formation
• GO:0061644 protein localization to CENP-A containing chromatin

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0043505 CENP-A containing nucleosome
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7nl0, PDBe:7nl0, PDBj:7nl0
• PDBsum: 7nl0
• PubMed: 34354236
• UniProt: P04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)