Structure of PDB 7nhc Chain C Binding Site BS01

Receptor Information
>7nhc Chain C (length=247) Species: 88776 (Influenza A virus (A/Brevig Mission/1/1918(H1N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM
MAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN
RNGPTTSAVHYPKIYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPG
HADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISP
LMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nhc Mapping inhibitory sites on the RNA polymerase of the 1918 pandemic influenza virus using nanobodies.
Resolution2.87 Å
Binding residue
(original residue number in PDB)
S36 G37 R38 E40 R46
Binding residue
(residue number reindexed from 1)
S36 G37 R38 E40 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
GO:0019865 immunoglobulin binding
Biological Process
GO:0001172 RNA-templated transcription
GO:0006351 DNA-templated transcription
GO:0006370 7-methylguanosine mRNA capping
GO:0019049 virus-mediated perturbation of host defense response
GO:0019083 viral transcription
GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
GO:0039545 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity
GO:0039694 viral RNA genome replication
GO:0075526 cap snatching
Cellular Component
GO:0033650 host cell mitochondrion
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nhc, PDBe:7nhc, PDBj:7nhc
PDBsum7nhc
PubMed35017564
UniProtQ3HM41|PB2_I18A0 Polymerase basic protein 2 (Gene Name=PB2)

[Back to BioLiP]