Structure of PDB 7nha Chain C Binding Site BS01

Receptor Information

>7nha Chain C (length=249) Species: 88776 (Influenza A virus (A/Brevig Mission/1/1918(H1N1)))

MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM
MAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN
RNGPTTSAVHYPKIYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPG
HADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISP
LMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGE

Ligand information

>7nha Chain E (length=8)

ggccugcu

........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nha Mapping inhibitory sites on the RNA polymerase of the 1918 pandemic influenza virus using nanobodies.
• Resolution: 2.91 Å
• Binding residue (original residue number in PDB): S36 R38 R46
• Binding residue (residue number reindexed from 1): S36 R38 R46

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003968 RNA-dependent RNA polymerase activity
• GO:0019865 immunoglobulin binding

Biological Process

• GO:0001172 RNA-templated transcription
• GO:0006351 DNA-templated transcription
• GO:0006370 7-methylguanosine mRNA capping
• GO:0019049 virus-mediated perturbation of host defense response
• GO:0019083 viral transcription
• GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
• GO:0039545 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity
• GO:0039694 viral RNA genome replication
• GO:0075526 cap snatching

Cellular Component

• GO:0033650 host cell mitochondrion
• GO:0042025 host cell nucleus
• GO:0044423 virion component

External links

• PDB: RCSB:7nha, PDBe:7nha, PDBj:7nha
• PDBsum: 7nha
• PubMed: 35017564
• UniProt: Q3HM41|PB2_I18A0 Polymerase basic protein 2 (Gene Name=PB2)