Structure of PDB 7n0w Chain C Binding Site BS01

Receptor Information

>7n0w Chain C (length=201) Species: 6523 (Lymnaea stagnalis)

LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDV
VFWQQTTWSDRTLAWNHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQL
ARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISV
DPTTEDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
G

Ligand information

>7n0w Chain G (length=14) Species: 1519798 (Conus australis)

CCARNPACRHNHPC

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7n0w Rigidity of loop 1 contributes to equipotency of globular and ribbon isomers of alpha-conotoxin AusIA.
• Resolution: 2.46 Å
• Binding residue (original residue number in PDB): Y89 W143 T144 H146 Y185 C188 E190 Y192
• Binding residue (residue number reindexed from 1): Y87 W141 T142 H144 Y181 C184 E186 Y188

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
• GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007165 signal transduction
• GO:0007268 chemical synaptic transmission
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042391 regulation of membrane potential
• GO:0050877 nervous system process
• GO:0060078 regulation of postsynaptic membrane potential
• GO:0060079 excitatory postsynaptic potential

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0043005 neuron projection
• GO:0043083 synaptic cleft
• GO:0045202 synapse
• GO:0098794 postsynapse

External links

• PDB: RCSB:7n0w, PDBe:7n0w, PDBj:7n0w
• PDBsum: 7n0w
• PubMed: 34753970
• UniProt: P58154|ACHP_LYMST Acetylcholine-binding protein