Structure of PDB 7mqh Chain C Binding Site BS01

Receptor Information

>7mqh Chain C (length=205) Species: 38323 (Bartonella henselae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TEIRVHQGDLPNLDNYRIDAVAVDTETLGLQPHRDRLCVVQLSSGDGTAD
VIQIAKGQKSAPNLVRLLSDRDITKIFHFGRFDLAILAHTFGVMPDVVFC
TKIASKLTRTYTDRHGLKEICGELLNVNISKQQQSSDWAAETLSRAQIEY
AASDVLYLHRLKDIFEERLKREERESVAKACFQFLPMRANLDLLGWSEID
IFAHS

Ligand information

>7mqh Chain D (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7mqh Structural characterization of NrnC identifies unifying features of dinucleotidases.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	E27 T28 G30 L31 H79 F80 K103 G117
Binding residue (residue number reindexed from 1)	E26 T27 G29 L30 H78 F79 K102 G116

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0004527	exonuclease activity
GO:0008408	3'-5' exonuclease activity

	Biological Process
GO:0006139	nucleobase-containing compound metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7mqh, PDBe:7mqh, PDBj:7mqh
PDBsum	7mqh
PubMed	34533457
UniProt	X5MEI1

[Back to BioLiP]