Structure of PDB 7m5c Chain C Binding Site BS01

Receptor Information
>7m5c Chain C (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEQVAQDTEEVFRSYVFYRHQQEQADPEMVTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVA
LLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAA
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m5c Structural basis of BAK activation in mitochondrial apoptosis initiation.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		I85 Y89 E92 F93 M96 H99 I114 S117 L118 N124 G126 R127 F134
Binding residue
(residue number reindexed from 1)		I55 Y59 E62 F63 M66 H69 I84 S87 L88 N94 G96 R97 F104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7m5c, PDBe:7m5c, PDBj:7m5c
PDBsum7m5c
PubMed35017502
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]