Structure of PDB 7l0r Chain C Binding Site BS01

Receptor Information

>7l0r Chain C (length=308) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARQSTVDYYLGS
LALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATAL
NVVSLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTM
GLQNLSGDGTHPGGLVCTPIVDTATLKVVIQVNTFMSFLFPMLVASILNT
VIANKLTVMVHQAANMTIEPGRVQALRRGVLVLRAVVIAFVVCWLPYHVR
RLMFCYISDEQWTTFLFDFYHYFYMLTNALVYVSAAINPILYNLVSANFR
QVFLSTLA

Ligand information

>7l0r Chain D (length=6) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRPYIL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7l0r Cryo-EM structure of an activated GPCR-G protein complex in lipid nanodiscs.
Resolution	4.2 Å
Binding residue (original residue number in PDB)	D54 F128 Y146 V224 R328 F331 I334 D336 W339 F344 Y347 Y351
Binding residue (residue number reindexed from 1)	D3 F70 Y88 V166 R251 F254 I257 D259 W262 F267 Y270 Y274

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0016492	G protein-coupled neurotensin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7l0r, PDBe:7l0r, PDBj:7l0r
PDBsum	7l0r
PubMed	33633398
UniProt	P20789\|NTR1_RAT Neurotensin receptor type 1 (Gene Name=Ntsr1)

[Back to BioLiP]