Structure of PDB 7l0p Chain C Binding Site BS01

Receptor Information

>7l0p Chain C (length=309) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARLQSTVDYYLG
SLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATA
LNVVSLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFT
MGLQNLSGDGTHPGGLVCTPIVDTATLKVVIQVNTFMSFLFPMLVASILN
TVIANKLTVMVHQAANMTIEPGRVQALRRGVLVLRAVVIAFVVCWLPYHV
RRLMFCYISDEQWTTFLFDFYHYFYMLTNALVYVSAAINPILYNLVSANF
RQVFLSTLA

Ligand information

>7l0p Chain D (length=6) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRPYIL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7l0p Cryo-EM structure of an activated GPCR-G protein complex in lipid nanodiscs.
Resolution	4.1 Å
Binding residue (original residue number in PDB)	L55 F128 H133 Y146 R327 R328 F331 I334 D336 W339 F344 Y347
Binding residue (residue number reindexed from 1)	L4 F71 H76 Y89 R251 R252 F255 I258 D260 W263 F268 Y271

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0016492	G protein-coupled neurotensin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7l0p, PDBe:7l0p, PDBj:7l0p
PDBsum	7l0p
PubMed	33633398
UniProt	P20789\|NTR1_RAT Neurotensin receptor type 1 (Gene Name=Ntsr1)

[Back to BioLiP]