Structure of PDB 7kdf Chain C Binding Site BS01

Receptor Information
>7kdf Chain C (length=95) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNLLDNPVEFLKEVRESFDIQQDVDAMKRIRHDLDVIKEESEARLKLYRS
LGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLG
Ligand information
>7kdf Chain E (length=28) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RAAAVTSTLKARIEKMKAKSRREGTTRT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kdf Structural basis of Stu2 recruitment to yeast kinetochores.
Resolution2.72 Å
Binding residue
(original residue number in PDB)		F14 S21 D23 Q26
Binding residue
(residue number reindexed from 1)		F10 S17 D19 Q22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7kdf, PDBe:7kdf, PDBj:7kdf
PDBsum7kdf
PubMed33591274
UniProtQ04477|SPC24_YEAST Kinetochore protein SPC24 (Gene Name=SPC24)

[Back to BioLiP]