Structure of PDB 7jwq Chain C Binding Site BS01

Receptor Information
>7jwq Chain C (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVEESGGGLVTPGTPLTLTCTVSGIDLSRYAMSWVRQAPGKGLEWIGIF
GSLGGIFYASWAKGRFTISKTSPTTVDLKITSPTTEDTATYFCARMPYTT
DRDFWGPGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS
NTKVDKKVEPKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jwq Discovery of a caspase cleavage motif antibody reveals insights into noncanonical inflammasome function.
Resolution2.001 Å
Binding residue
(original residue number in PDB)		Y31 I49 G51 S52 L53 G55 R95 P97 Y98 T99
Binding residue
(residue number reindexed from 1)		Y31 I49 G51 S52 L53 G55 R95 P97 Y98 T99
External links