Structure of PDB 7jl7 Chain C Binding Site BS01

Receptor Information
>7jl7 Chain C (length=96) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERIPVEADFLYAYSTVPGYYSWRTTMTGSWFIQSLCEMMTKYGSELELLQ
IMTRVNHKVALDFESTSNMPGFDAKKQIPCIVSMLTKEMYFTPLEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jl7 Remodeling hydrogen bond interactions results in relaxed specificity of Caspase-3.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		Y209 S210 W211 R212 T213
Binding residue
(residue number reindexed from 1)		Y20 S21 W22 R23 T24
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7jl7, PDBe:7jl7, PDBj:7jl7
PDBsum7jl7
PubMed33448281
UniProtQ98UI8

[Back to BioLiP]