Structure of PDB 7f4w Chain C Binding Site BS01

Receptor Information
>7f4w Chain C (length=280) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNSVDGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM
EPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTL
QMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKR
KWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPIS
DHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWA
AVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Ligand information
>7f4w Chain F (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYNYLYRLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f4w Profiling CD8 + T cell epitopes of COVID-19 convalescents reveals reduced cellular immune responses to SARS-CoV-2 variants.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
Y7 M45 E63 K66 H70 T73 N77 I80 Y84 M97 Y116 T143 W147 V152 Q155 Q156 Y159 T163 Y171
Binding residue
(residue number reindexed from 1)
Y12 M50 E68 K71 H75 T78 N82 I85 Y89 M102 Y121 T148 W152 V157 Q160 Q161 Y164 T168 Y176
Enzymatic activity
Enzyme Commision number ?
External links