Structure of PDB 7f3j Chain C Binding Site BS01

Receptor Information
>7f3j Chain C (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSV
GDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3j Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P1
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R132 K169
Binding residue
(residue number reindexed from 1)		R44 K81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7f3j, PDBe:7f3j, PDBj:7f3j
PDBsum7f3j
PubMed
UniProtQ9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)

[Back to BioLiP]