Structure of PDB 7f3i Chain C Binding Site BS01

Receptor Information
>7f3i Chain C (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLR
SVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3i Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P212121
Resolution2.25 Å
Binding residue
(original residue number in PDB)		W100 F101 N102 V103 R104 N105 F109 F120 H122 K153 G154 E156 Y173
Binding residue
(residue number reindexed from 1)		W14 F15 N16 V17 R18 N19 F23 F34 H36 K67 G68 E70 Y87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7f3i, PDBe:7f3i, PDBj:7f3i
PDBsum7f3i
PubMed
UniProtQ9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)

[Back to BioLiP]