Structure of PDB 7evr Chain C Binding Site BS01

Receptor Information
>7evr Chain C (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFD
SVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNP
Ligand information
>7evr Chain B (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YPPGYPMQAYVDPSNPNAGKVLLPTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7evr Structural basis of the interaction between SETD2 methyltransferase and hnRNP L paralogs for governing co-transcriptional splicing.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		I203 S205 R228
Binding residue
(residue number reindexed from 1)		I14 S16 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7evr, PDBe:7evr, PDBj:7evr
PDBsum7evr
PubMed34750379
UniProtP14866|HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L (Gene Name=HNRNPL)

[Back to BioLiP]