Structure of PDB 7ej7 Chain C Binding Site BS01

Receptor Information
>7ej7 Chain C (length=316) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILSVDELQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGLSEVKV
EKIKEAAGKIIQVGFIPATVQLDIRQRVYSLSTGSKQLDSILGGGIMTMS
ITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGEGKVAYIDTEGTFRPERI
KQIAEGYELDPESCLANVSYARALNSEHQMELVEQLGEELSSGDYRLIVV
DSIMANFRVDYCGRGELSERQQKLNQHLFKLNRLAEEFNVAVFLTNQVQS
DPGASALFASADGRKPIGGHVLAHASATRILLRKGRGDERVAKLQDSPDM
PEKECVYVIGEKGITD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ej7 Mechanisms of distinctive mismatch tolerance between Rad51 and Dmc1 in homologous recombination.
Resolution3.41 Å
Binding residue
(original residue number in PDB)		L232 S233 Q236 Q264 S265 P267 G283 G284 H285
Binding residue
(residue number reindexed from 1)		L217 S218 Q221 Q249 S250 P252 G268 G269 H270
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0042030 ATPase inhibitor activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000709 meiotic joint molecule formation
GO:0000730 DNA recombinase assembly
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006312 mitotic recombination
GO:0007130 synaptonemal complex assembly
GO:0007131 reciprocal meiotic recombination
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0042148 DNA strand invasion
GO:0051321 meiotic cell cycle
GO:0070192 chromosome organization involved in meiotic cell cycle
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ej7, PDBe:7ej7, PDBj:7ej7
PDBsum7ej7
PubMed34871438
UniProtP25453|DMC1_YEAST Meiotic recombination protein DMC1 (Gene Name=DMC1)

[Back to BioLiP]