Structure of PDB 7e9m Chain C Binding Site BS01

Receptor Information
>7e9m Chain C (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLE
LNKDERVSALEVLPDRVATSDAHLADTMIGKAVEHMFETEDGSKDEWRGM
VLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPPGEVVDSLVG
KQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
Ligand information
>7e9m Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FAAPAEVRHFTDGSFPAGFVLQLFSH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e9m Molecular basis for SPINDOC-Spindlin1 engagement and its role in transcriptional inhibition
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M154 T169 E171 P174 V210 K216 Q217 V218 E219 Y220 F247 D249 D250 Y254 V255 Y256 D257 L258 V259 K260 T261
Binding residue
(residue number reindexed from 1)		M100 T115 E117 P120 V145 K151 Q152 V153 E154 Y155 F182 D184 D185 Y189 V190 Y191 D192 L193 V194 K195 T196
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035064 methylated histone binding
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0007276 gamete generation
GO:0009303 rRNA transcription
GO:0016055 Wnt signaling pathway
GO:0030177 positive regulation of Wnt signaling pathway
GO:0045893 positive regulation of DNA-templated transcription
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005819 spindle
GO:0005829 cytosol
GO:0031965 nuclear membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e9m, PDBe:7e9m, PDBj:7e9m
PDBsum7e9m
PubMed
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]