Structure of PDB 7e1b Chain C Binding Site BS01

Receptor Information
>7e1b Chain C (length=209) Species: 670 (Vibrio parahaemolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQTLLLVEDDKNLADGLLVSLEQAGYECLHVERIADVEPQWKKADLVILD
RQLPDGDSVQHLPEWKKIKDVPVILLTALVTVKDKVAGLDSGANDYLTKP
FAEAELFARIRAQLRANADKVMTKDLEIDRATREVIFKGDLITLTRTEFD
LLLFLASNLGRVFTRDELLDHVWGYNTTRTVDTHVLQLRQKLPGLEIETL
RGVGYKMKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e1b Structural basis of phosphorylation-induced activation of the response regulator VbrR.
Resolution4.587 Å
Binding residue
(original residue number in PDB)
R190 L197 R200 R212 G213
Binding residue
(residue number reindexed from 1)
R179 L186 R189 R201 G202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7e1b, PDBe:7e1b, PDBj:7e1b
PDBsum7e1b
PubMed36647726
UniProtQ87HP4

[Back to BioLiP]