Structure of PDB 7dz9 Chain C Binding Site BS01

Receptor Information
>7dz9 Chain C (length=180) Species: 796620 (Vibrio caribbeanicus ATCC BAA-2122) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEEILDRIINPLSAKPLTKKEHIYTSLVLQSSQSLILSACPSLQSQRQFC
SFEYHQQFIDWCFFNKKRTDWCLALSFYQYLSYKNEQVSVEILKELIHLA
CSQWTYADKSTNQTVVICHTRLPSMVFGGNKSLFAQEFREVFLLETEQLK
PFIQSHVPDGYFVYWILRDDSEYPSTMGEK
Ligand information
>7dz9 Chain E (length=23) Species: 796620 (Vibrio caribbeanicus ATCC BAA-2122) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MKNDKKVVVKVKDKEMTCGAFNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dz9 Crystal structure and catalytic mechanism of the MbnBC holoenzyme required for methanobactin biosynthesis.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Q30 S31 S34 A39 H98 S102 Q103 Y106 R139 E140 V141 F142 L143 L144 D170 S171 Y173
Binding residue
(residue number reindexed from 1)		Q30 S31 S34 A39 H98 S102 Q103 Y106 R139 E140 V141 F142 L143 L144 D170 S171 Y173
Enzymatic activity
Enzyme Commision number ?
External links