Structure of PDB 7dnf Chain C Binding Site BS01

Receptor Information
>7dnf Chain C (length=158) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDLGKKLLEAARAGQDDEVRILMANGADVNANDVYGITPLHLAAYMGHL
EIVEVLLKYGVDVNASDQFGNTPLHLAADDGHLEIVEVLLKHGTDVNATD
TWGSTPLHLAAHRGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNED
LAEILQKL
Ligand information
>7dnf Chain B (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRIHIGPGRAFYTTPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dnf Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		E20 R23 Y46 I48 L53 Y56 M57
Binding residue
(residue number reindexed from 1)		E10 R13 Y36 I38 L43 Y46 M47
External links