Structure of PDB 7dbh Chain C Binding Site BS01

Receptor Information
>7dbh Chain C (length=94) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILEL
AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
Ligand information
>7dbh Chain I (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccggtgccgaggccgctcaattggtcgtagacagctctagcaccgctta
aacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattactc
cctagtctccaggcacgtgtcagata
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dbh Unusual nucleosome formation and transcriptome influence by the histone H3mm18 variant.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		T16 R17 R77
Binding residue
(residue number reindexed from 1)		T1 R2 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dbh, PDBe:7dbh, PDBj:7dbh
PDBsum7dbh
PubMed34929737
UniProtC0HKE1|H2A1B_MOUSE Histone H2A type 1-B (Gene Name=H2ac4)

[Back to BioLiP]