Structure of PDB 7d7v Chain C Binding Site BS01

Receptor Information
>7d7v Chain C (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQ
AFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>7d7v Chain A (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgcaacauccccgccgguugggcgcauugcacuccgcgcagugaaccgg
cugcgcc
<<<<.........<<<<<<<..<<<<..........>>>>....>>>>>>
>.>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d7v Structural distinctions between NAD+ riboswitch domains 1 and 2 determine differential folding and ligand binding.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y110 N112 N113 E116 K119 S145 L146 K147 M148 R149 Q151 F153 Q182 Y183 K185 D187 S188 D189
Binding residue
(residue number reindexed from 1)		Y9 N11 N12 E15 K18 S44 L45 K46 M47 R48 Q50 F52 Q81 Y82 K84 D86 S87 D88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7d7v, PDBe:7d7v, PDBj:7d7v
PDBsum7d7v
PubMed33170270
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]