Structure of PDB 7cby Chain C Binding Site BS01

Receptor Information
>7cby Chain C (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQ
NSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cby Structural Basis for DNA Recognition by FOXG1 and the Characterization of Disease-causing FOXG1 Mutations.
Resolution1.646 Å
Binding residue
(original residue number in PDB)		L204 R230 H231 S234 K241 N253 W255 K272
Binding residue
(residue number reindexed from 1)		L28 R54 H55 S58 K65 N77 W79 K96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7cby, PDBe:7cby, PDBj:7cby
PDBsum7cby
PubMed33058871
UniProtP55316|FOXG1_HUMAN Forkhead box protein G1 (Gene Name=FOXG1)

[Back to BioLiP]