Structure of PDB 7c9o Chain C Binding Site BS01

Receptor Information
>7c9o Chain C (length=80) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HQLPLARIKKIMKADEDVRMISAEAPVLFAKACELFILELTIRSWLHAEE
NKRRTLQRNDVAAAIARTDVFDFLVDIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c9o Structural Insight into DNA Recognition by CCT/NF-YB/YC Complexes in Plant Photoperiodic Flowering.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		P183 L184 A185
Binding residue
(residue number reindexed from 1)		P4 L5 A6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:7c9o, PDBe:7c9o, PDBj:7c9o
PDBsum7c9o
PubMed32843433
UniProtA6BLW4|NFYC2_ORYSJ Nuclear transcription factor Y subunit C-2 (Gene Name=NFYC2)

[Back to BioLiP]