Structure of PDB 7bye Chain C Binding Site BS01

Receptor Information
>7bye Chain C (length=100) Species: 272620 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YCPARGDVILLDFNPKRPALVVSDDLFNQVTGFAVVCPITNQIKGYPFEV
PVDGTTKTTGVILADQVKSLDWKARAARTVDSVSGETVTTVVDMVSKIIK
Ligand information
>7bye Chain A (length=29) Species: 573 (Klebsiella pneumoniae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTLEELLGQCTAENRHHEYLCDSQGKEML
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bye Toxin-antitoxin complex from klebsiella pneumoniae
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F16 R28 D35 L37 F38 V41 Q77 K79 D82
Binding residue
(residue number reindexed from 1)		F13 R17 D24 L26 F27 V30 Q66 K68 D71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Biological Process
GO:0006402 mRNA catabolic process
GO:0016075 rRNA catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7bye, PDBe:7bye, PDBj:7bye
PDBsum7bye
PubMed
UniProtA6TJ73

[Back to BioLiP]