Structure of PDB 7bqz Chain C Binding Site BS01

Receptor Information
>7bqz Chain C (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYD
GFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFE
TEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRI
MEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDF
HIYVYDLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bqz Molecular basis for histone H3 "K4me3-K9me3/2" methylation pattern readout by Spindlin1.
Resolution3.101 Å
Binding residue
(original residue number in PDB)		W62 W72 Y91 F94 D95 C96 Y98 F141 W151 Y170 D173 Y177 Y179 D184 D189
Binding residue
(residue number reindexed from 1)		W20 W30 Y49 F52 D53 C54 Y56 F99 W109 Y128 D131 Y135 Y137 D142 D147
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:7bqz, PDBe:7bqz, PDBj:7bqz
PDBsum7bqz
PubMed32994220
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]