Structure of PDB 7bn3 Chain C Binding Site BS01

Receptor Information
>7bn3 Chain C (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSEL
LHMLESPESLRSKVDEAVAVLQAHQAKEAAAAA
Ligand information
>7bn3 Chain F (length=12) Species: 11137 (Human coronavirus 229E) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PLLNPSALEFNP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bn3 Large-scale phage-based screening reveals extensive pan-viral mimicry of host short linear motifs
Resolution1.93 Å
Binding residue
(original residue number in PDB)		G563 F567 G579 K580 T582 M584 E587 E609 A610 V613
Binding residue
(residue number reindexed from 1)		G20 F24 G36 K37 T39 M41 E44 E66 A67 V70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7bn3, PDBe:7bn3, PDBj:7bn3
PDBsum7bn3
PubMed
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]