Structure of PDB 7b4w Chain C Binding Site BS01

Receptor Information
>7b4w Chain C (length=159) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGATPLHLAAWTGHLEI
VEVLLKTGADVNAVDSVGYTPLHLAAAEGHLEIVEVLLKTGADVNAQDAQ
GITPLHLAAWYGHLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIA
EVLQKAAKL
Ligand information
>7b4w Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4w Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		W56 D77 V79 Y81 A89 E90 Q112 W122 Y123 D143 F145
Binding residue
(residue number reindexed from 1)		W44 D65 V67 Y69 A77 E78 Q100 W110 Y111 D131 F133
External links