Structure of PDB 7b4v Chain C Binding Site BS01

Receptor Information
>7b4v Chain C (length=126) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAARAGQDDEVRILMANGADVNASDADVGATPLHLAAWAGHLE
IVEVLLKTGADVNAVDIWGLTPLHLAAAVGHLEIVEVLLKHGADVNAQDK
FGKTPFDLAIDNGNEDIAEVLQKAAK
Ligand information
>7b4v Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4v Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		E20 R23
Binding residue
(residue number reindexed from 1)		E8 R11
External links