Structure of PDB 7b4u Chain C Binding Site BS01

Receptor Information
>7b4u Chain C (length=128) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLGKKLLEAARAGQDDEVRILMANGADVNASDADVGATPLHLAAWAGHL
EIVEVLLKTGADVNAVDIWGLTPLHLAAAVGHLEIVEVLLKHGADVNAQD
KFGKTPFDLAIDNGNEDIAEVLQKAAKL
Ligand information
>7b4u Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4u Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		V47 A49 W57 D78 W80 L87 A90 F113 D123 N124
Binding residue
(residue number reindexed from 1)		V36 A38 W46 D67 W69 L76 A79 F102 D112 N113
External links