Structure of PDB 6zlq Chain C Binding Site BS01

Receptor Information

>6zlq Chain C (length=174) Species: 10090 (Mus musculus)

SQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFF
RELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALA
MEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNL
RRVASLGEYLFERLTLKHDGDIES

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 6zlq Chain C Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6zlq Folding of an Intrinsically Disordered Iron-Binding Peptide in Response to Sedimentation Revealed by Cryo-EM.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): C127 E131
• Binding residue (residue number reindexed from 1): C125 E129
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008199 ferric iron binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis

Cellular Component

• GO:0005576 extracellular region
• GO:0005737 cytoplasm
• GO:0005764 lysosome
• GO:0005776 autophagosome
• GO:0031410 cytoplasmic vesicle
• GO:0044754 autolysosome
• GO:0070288 ferritin complex
• GO:0071682 endocytic vesicle lumen

External links

• PDB: RCSB:6zlq, PDBe:6zlq, PDBj:6zlq
• PDBsum: 6zlq
• PubMed: 33166133
• UniProt: P29391|FRIL1_MOUSE Ferritin light chain 1 (Gene Name=Ftl1)