Structure of PDB 6yli Chain C Binding Site BS01

Receptor Information
>6yli Chain C (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAMSQSNRELVVDFLSYKLSQKGYSWSQFSEGTESEAVKQALREAGDEFE
LRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGG
ALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNN
AAA
Ligand information
>6yli Chain D (length=23) Species: 287889 (Trichoplax sp. H2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTSEIGRHLAQLGDSYSVRFQNE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yli Ancient and conserved functional interplay between Bcl-2 family proteins in the mitochondrial pathway of apoptosis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		A57 F61 R64 Y65 L72 Q75 Q89 V90 E93 L94 N100 G102 R103 F110 L158 Y159
Binding residue
(residue number reindexed from 1)		A45 F49 R52 Y53 L60 Q63 Q77 V78 E81 L82 N88 G90 R91 F98 L146 Y147
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6yli, PDBe:6yli, PDBj:6yli
PDBsum6yli
PubMed32998881
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]