Structure of PDB 6yac Chain C Binding Site BS01

Receptor Information

>6yac Chain C (length=80) Species: 3888 (Pisum sativum)

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGC
KRCESACPTDFLSVRVYLWHETTRSMGLAY

Ligand information

• Ligand ID: SF4
• InChI: InChI=1S/4Fe.4S
• InChIKey: LJBDFODJNLIPKO-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
  CACTVS 3.385: S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
• Formula: Fe4 S4
• Name: IRON/SULFUR CLUSTER
• PDB chain: 6yac Chain C Residue 3002

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6yac The structure of a triple complex of plant photosystem I with ferredoxin and plastocyanin.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): C21 P22 V25 C48 V49 G50 C51 K52 R53 C54 V67
• Binding residue (residue number reindexed from 1): C20 P21 V24 C47 V48 G49 C50 K51 R52 C53 V66
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009534 chloroplast thylakoid
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:6yac, PDBe:6yac, PDBj:6yac
• PDBsum: 6yac
• PubMed: 33020607
• UniProt: P10793|PSAC_PEA Photosystem I iron-sulfur center (Gene Name=psaC)