Structure of PDB 6y5d Chain C Binding Site BS01

Receptor Information
>6y5d Chain C (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN
IQAVLLP
Ligand information
>6y5d Chain I (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcctggagaatcccggtgccgaggccgctcaattggtcgtagacagctc
tagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcca
aggggattactccctagtctccaggcacgtgtcagatatatacatcctgt
gat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y5d Structural mechanism of cGAS inhibition by the nucleosome.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		R12 A13 K16 R18 R21 R33 R78
Binding residue
(residue number reindexed from 1)		R1 A2 K5 R7 R10 R22 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y5d, PDBe:6y5d, PDBj:6y5d
PDBsum6y5d
PubMed32911482
UniProtQ6FI13|H2A2A_HUMAN Histone H2A type 2-A (Gene Name=H2AC18)

[Back to BioLiP]