Structure of PDB 6xn3 Chain C Binding Site BS01

Receptor Information
>6xn3 Chain C (length=139) Species: 1360 (Lactococcus lactis subsp. lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TELKIGNEKVNSTNFGDFAEKAIRGINHKPFVNSKGGEQKITTSKIRGIL
ELVNKVYNRVINTNDVELSENILADIAYIKVKIAYESGREPVVKDFIQRT
AFTAAITDVMNQRTRESFLLFARYVESLIAYFKFYGGKD
Ligand information
>6xn3 Chain T (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggaguugaagcuugguucaaagaacguaucaag
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xn3 Structural and biochemical characterization of in vivo assembled Lactococcus lactis CRISPR-Csm complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T53 S55 K56 R58 R100 K149
Binding residue
(residue number reindexed from 1)		T42 S44 K45 R47 R89 K138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6xn3, PDBe:6xn3, PDBj:6xn3
PDBsum6xn3
PubMed35351985
UniProtL0CFW2

[Back to BioLiP]