Structure of PDB 6xkb Chain C Binding Site BS01

Receptor Information
>6xkb Chain C (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEK
FIKKCKPEYKVPGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYL
YLCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xkb Structural basis for the recognition of the S2, S5-phosphorylated RNA polymerase II CTD by the mRNA anti-terminator protein hSCAF4.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		I21 S22 R23 A24 M26 K31 Y64 D67 S68 R71 Q72 H75 R112 L116
Binding residue
(residue number reindexed from 1)		I22 S23 R24 A25 M27 K32 Y65 D68 S69 R72 Q73 H76 R113 L117
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xkb, PDBe:6xkb, PDBj:6xkb
PDBsum6xkb
PubMed34897689
UniProtO95104|SCAF4_HUMAN SR-related and CTD-associated factor 4 (Gene Name=SCAF4)

[Back to BioLiP]