Structure of PDB 6xa7 Chain C Binding Site BS01

Receptor Information
>6xa7 Chain C (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRHVACLARSERGLGFSIAGGKSTPYRAGDAGIFVSRIAEGGAAHRAGT
LQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xa7 Structural basis of the human Scribble-Vangl2 association in health and disease.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
L872 F874 S875 I876 A877 S895 R896 H928 V932
Binding residue
(residue number reindexed from 1)
L15 F17 S18 I19 A20 S37 R38 H70 V74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xa7, PDBe:6xa7, PDBj:6xa7
PDBsum6xa7
PubMed33684218
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]